← #privacy

#privacy

98 episodes · Page 3 of 5

#1743: Why the SEC’s Climate Rule Vanished

The SEC’s landmark climate disclosure rule is gone. Here’s what happened, and why companies still have to report emissions.

2026sustainabilityprivacy

#1722: The Dark Web Is Smaller Than You Think

Forget the iceberg myth—the dark web is more like a tiny shed behind a skyscraper, with only 3 million users and 100k sites.

privacycybersecuritytor

#1721: AI Doxxing: Why Your Writing Style Is a Liability

AI tools now identify anonymous users by analyzing their unique writing patterns, making traditional privacy measures less effective.

privacydigital-privacyai-detection

#1719: Why Pattern Matching Fails for PII at Scale

Regex alone is brittle; NER is expensive. See how hybrid frameworks like Presidio balance speed and accuracy to stop data leaks.

privacycybersecurityosint

#1234: Why Hashing Fails: Building Context-Aware Redaction Pipelines

Learn how to bridge the "anonymization gap" and protect sensitive data without destroying its utility for analysis.

privacytokenizationdata-integrity

#1082: Stop Ruining Your Website Speed With Tracking Scripts

Stop slowing down your site with invasive trackers. Learn how to balance privacy and performance using edge-side and proxy-based analytics.

privacyarchitecturedata-integrity

#1079: When Thin Walls Betray Your Voice

How do you keep your voice private when walls are thin? Explore the high-tech muzzles and throat mics designed for the remote work era.

audio-processingprivacyhardware-engineering

#1077: Will Your Browser Replace Your OS for Local AI?

See how Web GPU and Web NN are turning your browser into a local AI engine, ending the era of complex DIY setups and protecting your privacy.

local-aiprivacybrowser-cached-models

#1074: The $200 Information Tax: Why News Bundling is Broken

Tired of hitting paywalls? We explore why a "Spotify for news" doesn't exist and how AI might finally force the industry to change.

ai-agentsprivacynetworking

#1071: Beyond the Kill Switch: Advanced Router VPN Routing

Stop breaking your smart home. Learn how to use domain-based split routing and WireGuard to gain surgical control over your network.

networkingprivacysmart-home

#1053: The Soul and the Shield: Mastering Signature Management

Learn how to stay safe in a high-threat world by reducing your physical and digital signature without losing your sense of identity.

privacysituational-awarenessexecutive-protection

#990: Radical Transparency vs. Trash Security

Is your trash a gold mine for identity thieves? Learn the essentials of physical InfoSec and how to properly destroy sensitive documents.

privacyphysical-securityfinancial-fraud

#985: Banking on Surveillance: The Secret History of KYC

How did opening a bank account become a security clearance? Trace the evolution of KYC from the 1970s to the age of AI surveillance.

surveillance-technologyprivacypolitical-historykyc-regulationsanti-money-laundering

#980: The Rosehill Audit: Mapping a Digital Footprint

From Linux automation to AI prompts, discover the digital blueprint of a modern systems builder in this deep-dive investigative audit.

prompt-engineeringprivacylocal-ai

#963: The Truth Behind Iran’s Digital Iron Curtain

How do we measure public opinion in a state where dissent is a crime? Explore the data behind Iran’s hidden social and political reality.

privacynetworkingdata-integrity

#960: Why Your $2,000 Smart TV Lags Like a Budget Phone

Why does a $2,000 TV struggle with basic menus? Discover the hidden "Smart TV Tax" and why your display's brain is often stuck in the past.

smart-homearchitectureprivacy

#952: Can Amateur Sleuths Outsmart the CIA?

Explore how OSINT evolved from a niche hobby into a billion-dollar industry that rivals state intelligence agencies in the modern age.

osintsituational-awarenessprivacy

#864: The Death of SaaS: Building Your Own Bespoke AI Tools

Stop paying for dozens of subscriptions. Learn how AI agents are allowing anyone to build custom, private software tailored to their exact needs.

ai-agentsprivacysoftware-development

#806: Digital Litter: The War on Automated Email Sequences

Tired of 20-part email sequences? Explore the legal and technical battle against aggressive digital marketing and "cognitive inbox fragmentation."

privacydigital-privacydrip-campaigns

#801: When Code Enforces What Courts Can't

Can blockchain fix bad landlords and hidden salaries? Explore how smart contracts and Zero-Knowledge Proofs are rebuilding trust in 2026.

smart-contractsprivacydata-integrity

#798: Beyond the Button: How AI Learns From Your Feedback

Ever wonder if your AI feedback actually matters? Discover how ratings shape global models and the privacy tech keeping your data safe.

fine-tuningprivacydata-integrity

#796: Can Your Data Legally Leave the Country?

Explore the shift from a global cloud to localized data sovereignty and why legal jurisdictions are the new physical borders of 2026.

privacynetworkingdata-sovereignty

#780: Escaping the Golden Cage: The Guide to De-Googling in 2026

Is it possible to leave Google in 2026? Explore the tools and trade-offs of reclaiming your digital sovereignty from the AI-driven golden cage.

privacydigital-sovereigntyde-googling

#776: Is Your Inbox Watching You Back?

A tiny 1x1 image is watching your every move. Explore how tracking pixels turn your inbox into a surveillance tool and how to fight back.

privacyfingerprintingemail-tracking